PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM12G13820.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRF
Protein Properties Length: 411aa    MW: 43958.1 Da    PI: 9.2388
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM12G13820.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC74.21.4e-23108152145
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                      d+epgrCrRtDGKkWRCsr+++ ++k+CErH++rgr+rsrk++e 
  OGLUM12G13820.1 108 DSEPGRCRRTDGKKWRCSRDAVVDQKYCERHINRGRHRSRKHVEG 152
                      689***************************************986 PP

2QLQ61.32.7e-213773137
              QLQ  1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                     ++FT++Q+++L++Q+l+yK+++an+PvP++Ll++i++
  OGLUM12G13820.1 37 GPFTPTQWMELEHQALIYKHIVANAPVPARLLLPIRR 73
                     59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.8E-123773IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.9573873IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.7E-153872IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.527108152IPR014977WRC domain
PfamPF088798.8E-20110151IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MAMATPTTNG SFLLGSGLDC GSSDVARMQG VLARVRGPFT PTQWMELEHQ ALIYKHIVAN  60
APVPARLLLP IRRSLHPPVF PHFSSGGILG SSSLGWGSFQ LGYSGSADSE PGRCRRTDGK  120
KWRCSRDAVV DQKYCERHIN RGRHRSRKHV EGQSSHAAKA TVPAIAQPPI GASNGKLSGS  180
HGVSNELTKT LATNRMMLDK ANLIERSQDY TNQQHNILQN NTKGDNWSEE MSSQADYAVI  240
PAGSLMNTPQ SANLNPIPQQ QRCKQSLFGK GIQHDDIQLS ISIPVDNSDL PTNYNKAQMD  300
HVVGGSSNGG NNTRASWIPG SWEASIGGPL GEFFTNTSSA SDDKGKSRHP PSLNLLADGH  360
TTSPQLQSPT GVLQMTSFSS VPSSTVSSPA GSLCNGLLTS GLVNAQTVQT L
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2415570.0AK241557.1 Oryza sativa Japonica Group cDNA, clone: J065178H17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618985.10.0PREDICTED: growth-regulating factor 7 isoform X2
SwissprotQ6AWY20.0GRF7_ORYSJ; Growth-regulating factor 7
TrEMBLA0A0E0BSS80.0A0A0E0BSS8_9ORYZ; Uncharacterized protein
STRINGBGIOSGA037400-PA0.0(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.12e-43growth-regulating factor 2